PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007988P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 271aa    MW: 29674.2 Da    PI: 9.0428
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007988P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.76.1e-341973155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    k+rlrWt++LHerFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  MELO3C007988P1 19 KQRLRWTHDLHERFVNAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 73
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.6991676IPR017930Myb domain
SuperFamilySSF466892.69E-171873IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-321874IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-261974IPR006447Myb domain, plants
PfamPF002494.2E-92172IPR001005SANT/Myb domain
PfamPF143796.8E-24105151IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MDPTNGNNAT SKNPNLASKQ RLRWTHDLHE RFVNAVAQLG GPDRATPKGV LRVMGVQGLT  60
IYHVKSHLQK YRLAKYLPDS SSDGKKTDKK DSSDILSNID GSSGMQITEA LKLQMEVQKR  120
LHEQLEVQRQ LQLRIEAQGK YLKKIIEEQQ KLSGVLSGAP AASAFTAPAS GDNCPEADKN  180
DPPTPASTSE FPRQEKVSKE RAQGKSVSID DSFSSHHEPL TPDSGCHSSP SESARPVKKQ  240
RQDMDGAFAK SEMILAHQIL ESSLNSTHKE *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU2841180.0EU284118.1 Cucumis sativus putative myb family transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008440944.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_008440943.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_008440942.10.0PREDICTED: protein PHR1-LIKE 1-like
SwissprotQ8GUN58e-50PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLB3FNK50.0B3FNK5_CUCSA; Putative myb family transcription factor
STRINGVIT_00s0475g00040.t011e-146(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF86103343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-89G2-like family protein